PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072481.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 238aa    MW: 24921.2 Da    PI: 8.1123
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072481.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.73.4e-402383262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++++lkcprCdstntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+s
  XP_011072481.1 23 EQEHLKCPRCDSTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNIPVGGGSRKNAKRS 83
                    57899****************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-261475IPR003851Zinc finger, Dof-type
PfamPF027011.0E-332581IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4882781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MQDPSLYSQI KAQVQQPLPQ FPEQEHLKCP RCDSTNTKFC YYNNYNLSQP RHFCKSCRRY  60
WTKGGALRNI PVGGGSRKNA KRSSSSSASS AAAKRPAAAA PSAPPSSNNS KNDDSRSKNG  120
ETAETLPLKG ENFVGQFGNL LEAGGSFSSL LGSSGGQFGN FLEGLGPNGS SLQVTDHFGD  180
PGSGQNVDPQ VLESGSSSNA DGFLNIQGGG SGGDTGCWSG GSTGWPDLAI YTPGPNFQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072481.11e-174PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotO821552e-41DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A022Q0V12e-98A0A022Q0V1_ERYGU; Uncharacterized protein
STRINGGLYMA07G01461.13e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-37DOF zinc finger protein 1